Tag Archives: Wooden Spoon Spanking

I need More Self-Discipline

spanking self spanking spanking herself girl spanking wooden spoon spanking bare bottom spanking spanking video punishedbrats spanking videos self spanking video spanking impact

*Stinging Impact*

SMACK SMACK SWAT Goes the solid spoon against Ava’s naked butt cheeks as she gives herself a serious self spanking disciplining.

spanking gif 1

Pretty Ava delivers a mighty hard spanking to her very own naked butt cheeks.

spanking gif 2

The naughty brat gives herself a very effective punishment spanking.

spanking gif 3

Ava was unhappy with how she was doing at school. She knew that she needed a good spanking but being away from home, there was no one to provide her with the correction she needed. So she took the matters into her own hands and took a wooden spoon to her bare bottom.

AMAZING!!!! Ava uses the wooden spoon  to redden her cheeks ever so brightly.

~WATCH A FREE VIDEO PREVIEW FROM THIS UPDATE~

A BURNING RED HOT SELF SPANKING ASS BLASTING TO REMEMBER!!!

See the beautiful girl spanking her ripe ass hard at Punished Brats Here->>>

punished-brats-spanking2

SPANKED WITH THE DREADED KITCHEN SPOON

spanking - Copyhand spanking - Copyspanking video - Copypunishment spanking - Copy mother daughtre spanking - Copy kitchen spanking - Copy hard spanking - Copy hand spanking - Copy red ass spanking - Copy red bottom spanking - Copywooden spoon spoon spanking - Copyspanking blog - Copy

Mummy bends her bratty girl over the kitchen bench,bares her perky ass and spanks her cheeks hard till they are glowing RED!!!

Mum uses the dreaded kitchen spoon to make her butt cheeks ultra red!!

**Click here to watch Spirit’s candid spanking interview**

Spirit has a curvy round spankable ass which receives lots of firm smack with hand and wooden spoon making it hot and ouch sore!

Spirit Sanctus is a tall, curvy bottomed dancer who has never shot any spanking scenes but had some great stories about being spanked by her young mom (played by Emily Parker) growing up and also she takes a birthday spanking since we shot her on that day.

Enjoy Spirit Sanctus spanking interviews and watch her Mother/daughter discipline spankings at Spanked Sweeties here->

001

BOUNCING BARE BUNS GET THE WOODEN SPOON

HOT GIRL PANTIESSPANKING HOT GIRL SPANKING KNICKERS SPANKING HOT AND HARD SPANKING HARD AND FAST SPANKING BIG BOTTOM SPANKING SPANKED HOT SPANKED BOTTOM

Very Pretty Michaela McGowen sticks out her every so bouncy,plump,juicy,smackable bottom for a painful spanking with a wooden spoon.

In no time her glorious ass is glowing red!

ASSMAZING!

Michaela McGowen’s bouncing bare buns get a wooden spoon spanking in a finale sequence to remember from House-guest from Hell. Skipping work to go snow-boarding incurs the wrath of Aunt Cindy, who sends her out to sit bare-bottomed in the snow. After that, the sting of a spanking is even more painful! But after the spoon, she has another treat in store – more snow!

BOUNCY RED BUM SPANKS HERE>>>

FIRMHANDSPANKINGS

MUMMY CLARE FONDA IS STERN AND CAN GIVE A MEAN SPANKING

naughty girl naughty girl spanking otk spanking video panties panties spanking spanking knickers pulling down knickers mother daughter spanking wooden spoon spanking spanked with a wooden spoon spanked over mummys knees spanking videos bare bottom spanking spanked red bottom

Meet the newest Sweetie Kimberly Brix who recreates a punishment spanking she received while growing up which she shares in her interview with Clare Fonda.

Kimberly’s Mum takes her across her lap and proceeds to smack her bare bottom till it is sore and red and she knows her bratty girl is feeling quite sorry.

spanking gif

Shorts so tight  they look like they have been sprayed on!! HOT!

Momma is S-T-R-I-C-T!!!!

GIF SPANKING

Momma Clare goes to town on her daughter bum smacking her perky cheeks looking oh so yummy in tiny naughty girl shorts.

spankedsweetiesMummy Clare Fonda spanks her bratty Miss whole heatedly.

**Click here to watch  Kimberly’s spanking interview**

Kimberly Brix is a young cutie with a curvy bottom who was spanked by her mom (played by Clare) a few times while growing up. Kimberly gives a very candid interview with some sizzling re-enactments that left her bottom “hurting to sit down” as she explains in her post shoot interview.

A super ouhcy OW spanking from Mummy indeed.

Enjoy Kimberly’s spanking interviews and watch her Mother/daughter discipline spankings at Spanked Sweeties here->

spanked-sweeties1

HARD BARE BOTTOM SPANKING FROM MUMMY

panties spankingpunished bratsMandie had been spreading rumors that the girl next door had been doing nasty things with boys at school. Mandie’s mom was in no way pleased with her little gossip monger. Mandie was taken off the couch and spanked in standing position over her panties. Soon, to Mandie’s distress, she was embarrassed beyond tolerance as her mother removed her panties and spanked upon her bare bottom. Soon, Mandie’s situation worsened as her mother applied a wooden spoon to her naked posterior. Mandie forgot about the fact that she was naked from the waist down and pleaded with her mother to stop as she danced to the rhythm of the spoon.
naughty girlNawwwwwww please NOT on the bare Mummy *sob*

Mandie is instructed by her strict Momma to remove her hello kitty panties and bare her perky bottom cheeks.

wooden spoon spanking hot spanking painful spanking hand spanking little bottom spanking bare ass spanking bare buttspanking

” Waaaaaaaaaaaaaaa Mummy it burns!!!!!!!!!!!!”

Little Brat Mandie cries out owiee OW a her mum lets the wooden spoon rain down hard across her trembling butt.

6As both her mother’s hands and wooden spoon struck her bare bottom, Mandie promised not to gossip any more. Her dance of pain wasn’t over until mother was sure that the lesson was learned.

Poor lil Mandie well spanked tushy is going to be stinging sore for a week after serious punishment from mummy!

Little adorable Mandie Rae super sensitive, soft little bottom cheeks deserve a wallop attack from mummy’s wicked wooden spoon till her botty cheeks are deep DEEP RED and she gets just that and mummy firm hand applied hard acrross her soft bottom  too over and over again till her ass is super sizzling  hot red at Punished Brats fantastic spanking world here->>>>>>>>

PUNISHEDBRATS

Snow Spanks Intruder Lily

NAUGHTY GIRLNAUGHTYGIRLMYSPANKINGROOMMATESNOWMERCYSPANKINGSPANKINGSSPANKSPANKSPANTIES SPANKINGBARE BOTTOM SPANKINGWOODEN SPOON SPANKINGHARD SPANKINGASS SPANKINGBUM SPANKINGBOTTOM SPANKINGSPANKED

Snow Mercy returns to her apartment to find a total stranger, Lily, sleeping on her sofa. Snow is increasing annoyed by this young lady who is crashing at her place without an invitation. So like any good resident of this apartment complex, Snow must teach Lily a good lesson with a sound spanking, using her hand, and a wooden spoon.

Snow makes the cutie squeal with solid burning swats with the wooden spoon.

The naughty little brats bottom is blushing red very quickly:)

Snow swats Lily’s naked ass with a wooden spoon ta My Spanking Roommate Here->>>

my-spanking-roommate1